From patchwork Fri Sep 5 17:11:51 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Kamel Bouhara X-Patchwork-Id: 69771 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from aws-us-west-2-korg-lkml-1.web.codeaurora.org (localhost.localdomain [127.0.0.1]) by smtp.lore.kernel.org (Postfix) with ESMTP id E047FCAC582 for ; Fri, 5 Sep 2025 17:12:09 +0000 (UTC) Received: from relay3-d.mail.gandi.net (relay3-d.mail.gandi.net [217.70.183.195]) by mx.groups.io with SMTP id smtpd.web11.600.1757092322573182217 for ; Fri, 05 Sep 2025 10:12:03 -0700 Authentication-Results: mx.groups.io; dkim=pass header.i=@bootlin.com header.s=gm1 header.b=UE5k7DIS; spf=pass (domain: bootlin.com, ip: 217.70.183.195, mailfrom: kamel.bouhara@bootlin.com) Received: by mail.gandi.net (Postfix) with ESMTPSA id DD8671F745; Fri, 5 Sep 2025 17:12:00 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1757092321; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version: content-transfer-encoding:content-transfer-encoding: in-reply-to:in-reply-to:references:references; bh=TdshuKc3JBs9nHUDs8YmBEUDRdQX76w/VNMM0A6Aibc=; b=UE5k7DISvCaF/yQx2ZbZF3370qXBPINGWWoeUS/bte9rMb4v2wLp4ODqPCB7YWIjKk5ebi eswT9IZn4mhlHUyNdjj+qKWDnCZyPvgyJZdQWxMTz/ufpZQPt5Ze8bWIeaSCUl5tg7TmP1 r0QC15xJga/6GNmzBHZqOP+ibD547OJEF6GH+dVlv1IQk2fygXf828S4Be5ioSym4Ir2SO TgFlAhq/amrdcatV2rFPu47dH+14RX1XosSSO2RqwWtvmKh2uv3eIT6dLGeyAhCBZwXEUD QV+YMTNtSqPHzbGzJ57pk/wPX3lqBdpFSjvBjaJ3wnVGSTuEOfgG6wQxnaupkQ== From: Kamel Bouhara To: openembedded-core@lists.openembedded.org Cc: JPEWhacker@gmail.com, thomas.petazzoni@bootlin.com, Miquel Raynal , mathieu.dubois-briand@bootlin.com, antonin.godard@bootlin.com, Pascal Eberhard , Richard Purdie , "Kamel Bouhara (Schneider Electric)" Subject: [PATCH 3/6] classes-global/license: Move functions to library code Date: Fri, 5 Sep 2025 19:11:51 +0200 Message-ID: <20250905171154.182825-4-kamel.bouhara@bootlin.com> X-Mailer: git-send-email 2.50.1 In-Reply-To: <20250905171154.182825-1-kamel.bouhara@bootlin.com> References: <20250905171154.182825-1-kamel.bouhara@bootlin.com> MIME-Version: 1.0 X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdeggdelgeeiucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkffojghfggfgsedtkeertdertddtnecuhfhrohhmpefmrghmvghluceuohhuhhgrrhgruceokhgrmhgvlhdrsghouhhhrghrrgessghoohhtlhhinhdrtghomheqnecuggftrfgrthhtvghrnhepuddukeekfeetgfeltdfgieeugeeggeejieejheekueevhffgffegkefgffeukedvnecukfhppeekkedrudeitddrvddvvddrvddvleenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeekkedrudeitddrvddvvddrvddvledphhgvlhhopehlohgtrghlhhhoshhtpdhmrghilhhfrhhomhepkhgrmhgvlhdrsghouhhhrghrrgessghoohhtlhhinhdrtghomhdpnhgspghrtghpthhtohepledprhgtphhtthhopehophgvnhgvmhgsvgguuggvugdqtghorhgvsehlihhsthhsrdhophgvnhgvmhgsvgguuggvugdrohhrghdprhgtphhtthhopeflrffghghhrggtkhgvrhesghhmrghilhdrtghomhdprhgtphhtthhopehthhhomhgrshdrphgvthgriiiiohhnihessghoohhtlhhinhdrtghomhdprhgtphhtthhopehmihhquhgvlhdrrhgrhihnrghlsegsohhothhlihhnrdgtohhmpdhrtghpthhto hepmhgrthhhihgvuhdrughusghoihhsqdgsrhhirghnugessghoohhtlhhinhdrtghomhdprhgtphhtthhopegrnhhtohhnihhnrdhgohgurghrugessghoohhtlhhinhdrtghomhdprhgtphhtthhopehprghstggrlhdrvggsvghrhhgrrhgusehsvgdrtghomhdprhgtphhtthhopehrihgthhgrrhgurdhpuhhrughivgeslhhinhhugihfohhunhgurghtihhonhdrohhrgh X-GND-Sasl: kamel.bouhara@bootlin.com List-Id: X-Webhook-Received: from li982-79.members.linode.com [45.33.32.79] by aws-us-west-2-korg-lkml-1.web.codeaurora.org with HTTPS for ; Fri, 05 Sep 2025 17:12:09 -0000 X-Groupsio-URL: https://lists.openembedded.org/g/openembedded-core/message/223028 From: Joshua Watt Moves several of the functions in license.bbclass to be library code New function dependencies were manually verified using bitbake-dumpsigs to ensure that bitbake identified the same dependencies even though they are now in library code (although the new function names mean that the task hashes still change) Signed-off-by: Joshua Watt Signed-off-by: Richard Purdie (cherry picked from commit 0333e04e353991260c5f67a72f80f3ab9dcf526a) Signed-off-by: Kamel Bouhara (Schneider Electric) --- meta/classes-global/base.bbclass | 10 +- meta/classes-global/license.bbclass | 165 ---------------------- meta/classes-recipe/license_image.bbclass | 14 +- meta/lib/oe/license.py | 163 +++++++++++++++++++++ 4 files changed, 175 insertions(+), 177 deletions(-) diff --git a/meta/classes-global/base.bbclass b/meta/classes-global/base.bbclass index 0999b42daa..f764f3ee2f 100644 --- a/meta/classes-global/base.bbclass +++ b/meta/classes-global/base.bbclass @@ -520,8 +520,8 @@ python () { bb.fatal('This recipe does not have the LICENSE field set (%s)' % pn) if bb.data.inherits_class('license', d): - check_license_format(d) - unmatched_license_flags = check_license_flags(d) + oe.license.check_license_format(d) + unmatched_license_flags = oe.license.check_license_flags(d) if unmatched_license_flags: for unmatched in unmatched_license_flags: message = "Has a restricted license '%s' which is not listed in your LICENSE_FLAGS_ACCEPTED." % unmatched @@ -575,7 +575,7 @@ python () { check_license = False if check_license and bad_licenses: - bad_licenses = expand_wildcard_licenses(d, bad_licenses) + bad_licenses = oe.license.expand_wildcard_licenses(d, bad_licenses) exceptions = (d.getVar("INCOMPATIBLE_LICENSE_EXCEPTIONS") or "").split() @@ -591,7 +591,7 @@ python () { for pkg in pkgs: remaining_bad_licenses = oe.license.apply_pkg_license_exception(pkg, bad_licenses, exceptions) - incompatible_lic = incompatible_license(d, remaining_bad_licenses, pkg) + incompatible_lic = oe.license.incompatible_license(d, remaining_bad_licenses, pkg) if incompatible_lic: skipped_pkgs[pkg] = incompatible_lic else: @@ -604,7 +604,7 @@ python () { for pkg in unskipped_pkgs: bb.debug(1, "Including the package %s" % pkg) else: - incompatible_lic = incompatible_license(d, bad_licenses) + incompatible_lic = oe.license.incompatible_license(d, bad_licenses) for pkg in skipped_pkgs: incompatible_lic += skipped_pkgs[pkg] incompatible_lic = sorted(list(set(incompatible_lic))) diff --git a/meta/classes-global/license.bbclass b/meta/classes-global/license.bbclass index d7c5d08a77..6e0de5f414 100644 --- a/meta/classes-global/license.bbclass +++ b/meta/classes-global/license.bbclass @@ -255,171 +255,6 @@ def find_license_files(d): return lic_files_paths -def return_spdx(d, license): - """ - This function returns the spdx mapping of a license if it exists. - """ - return d.getVarFlag('SPDXLICENSEMAP', license) - -def canonical_license(d, license): - """ - Return the canonical (SPDX) form of the license if available (so GPLv3 - becomes GPL-3.0-only) or the passed license if there is no canonical form. - """ - return d.getVarFlag('SPDXLICENSEMAP', license) or license - -def expand_wildcard_licenses(d, wildcard_licenses): - """ - There are some common wildcard values users may want to use. Support them - here. - """ - licenses = set(wildcard_licenses) - mapping = { - "AGPL-3.0*" : ["AGPL-3.0-only", "AGPL-3.0-or-later"], - "GPL-3.0*" : ["GPL-3.0-only", "GPL-3.0-or-later"], - "LGPL-3.0*" : ["LGPL-3.0-only", "LGPL-3.0-or-later"], - } - for k in mapping: - if k in wildcard_licenses: - licenses.remove(k) - for item in mapping[k]: - licenses.add(item) - - for l in licenses: - if l in oe.license.obsolete_license_list(): - bb.fatal("Error, %s is an obsolete license, please use an SPDX reference in INCOMPATIBLE_LICENSE" % l) - if "*" in l: - bb.fatal("Error, %s is an invalid license wildcard entry" % l) - - return list(licenses) - -def incompatible_license_contains(license, truevalue, falsevalue, d): - license = canonical_license(d, license) - bad_licenses = (d.getVar('INCOMPATIBLE_LICENSE') or "").split() - bad_licenses = expand_wildcard_licenses(d, bad_licenses) - return truevalue if license in bad_licenses else falsevalue - -def incompatible_pkg_license(d, dont_want_licenses, license): - # Handles an "or" or two license sets provided by - # flattened_licenses(), pick one that works if possible. - def choose_lic_set(a, b): - return a if all(oe.license.license_ok(canonical_license(d, lic), - dont_want_licenses) for lic in a) else b - - try: - licenses = oe.license.flattened_licenses(license, choose_lic_set) - except oe.license.LicenseError as exc: - bb.fatal('%s: %s' % (d.getVar('P'), exc)) - - incompatible_lic = [] - for l in licenses: - license = canonical_license(d, l) - if not oe.license.license_ok(license, dont_want_licenses): - incompatible_lic.append(license) - - return sorted(incompatible_lic) - -def incompatible_license(d, dont_want_licenses, package=None): - """ - This function checks if a recipe has only incompatible licenses. It also - take into consideration 'or' operand. dont_want_licenses should be passed - as canonical (SPDX) names. - """ - import oe.license - license = d.getVar("LICENSE:%s" % package) if package else None - if not license: - license = d.getVar('LICENSE') - - return incompatible_pkg_license(d, dont_want_licenses, license) - -def check_license_flags(d): - """ - This function checks if a recipe has any LICENSE_FLAGS that - aren't acceptable. - - If it does, it returns the all LICENSE_FLAGS missing from the list - of acceptable license flags, or all of the LICENSE_FLAGS if there - is no list of acceptable flags. - - If everything is is acceptable, it returns None. - """ - - def license_flag_matches(flag, acceptlist, pn): - """ - Return True if flag matches something in acceptlist, None if not. - - Before we test a flag against the acceptlist, we append _${PN} - to it. We then try to match that string against the - acceptlist. This covers the normal case, where we expect - LICENSE_FLAGS to be a simple string like 'commercial', which - the user typically matches exactly in the acceptlist by - explicitly appending the package name e.g 'commercial_foo'. - If we fail the match however, we then split the flag across - '_' and append each fragment and test until we either match or - run out of fragments. - """ - flag_pn = ("%s_%s" % (flag, pn)) - for candidate in acceptlist: - if flag_pn == candidate: - return True - - flag_cur = "" - flagments = flag_pn.split("_") - flagments.pop() # we've already tested the full string - for flagment in flagments: - if flag_cur: - flag_cur += "_" - flag_cur += flagment - for candidate in acceptlist: - if flag_cur == candidate: - return True - return False - - def all_license_flags_match(license_flags, acceptlist): - """ Return all unmatched flags, None if all flags match """ - pn = d.getVar('PN') - split_acceptlist = acceptlist.split() - flags = [] - for flag in license_flags.split(): - if not license_flag_matches(flag, split_acceptlist, pn): - flags.append(flag) - return flags if flags else None - - license_flags = d.getVar('LICENSE_FLAGS') - if license_flags: - acceptlist = d.getVar('LICENSE_FLAGS_ACCEPTED') - if not acceptlist: - return license_flags.split() - unmatched_flags = all_license_flags_match(license_flags, acceptlist) - if unmatched_flags: - return unmatched_flags - return None - -def check_license_format(d): - """ - This function checks if LICENSE is well defined, - Validate operators in LICENSES. - No spaces are allowed between LICENSES. - """ - pn = d.getVar('PN') - licenses = d.getVar('LICENSE') - from oe.license import license_operator, license_operator_chars, license_pattern - - elements = list(filter(lambda x: x.strip(), license_operator.split(licenses))) - for pos, element in enumerate(elements): - if license_pattern.match(element): - if pos > 0 and license_pattern.match(elements[pos - 1]): - oe.qa.handle_error('license-format', - '%s: LICENSE value "%s" has an invalid format - license names ' \ - 'must be separated by the following characters to indicate ' \ - 'the license selection: %s' % - (pn, licenses, license_operator_chars), d) - elif not license_operator.match(element): - oe.qa.handle_error('license-format', - '%s: LICENSE value "%s" has an invalid separator "%s" that is not ' \ - 'in the valid list of separators (%s)' % - (pn, licenses, element, license_operator_chars), d) - SSTATETASKS += "do_populate_lic" do_populate_lic[sstate-inputdirs] = "${LICSSTATEDIR}" do_populate_lic[sstate-outputdirs] = "${LICENSE_DIRECTORY}/" diff --git a/meta/classes-recipe/license_image.bbclass b/meta/classes-recipe/license_image.bbclass index 19b3dc55ba..b18a64d2bc 100644 --- a/meta/classes-recipe/license_image.bbclass +++ b/meta/classes-recipe/license_image.bbclass @@ -58,7 +58,7 @@ def write_license_files(d, license_manifest, pkg_dic, rootfs=True): import stat bad_licenses = (d.getVar("INCOMPATIBLE_LICENSE") or "").split() - bad_licenses = expand_wildcard_licenses(d, bad_licenses) + bad_licenses = oe.license.expand_wildcard_licenses(d, bad_licenses) pkgarchs = d.getVar("SSTATE_ARCHS").split() pkgarchs.reverse() @@ -66,17 +66,17 @@ def write_license_files(d, license_manifest, pkg_dic, rootfs=True): with open(license_manifest, "w") as license_file: for pkg in sorted(pkg_dic): remaining_bad_licenses = oe.license.apply_pkg_license_exception(pkg, bad_licenses, exceptions) - incompatible_licenses = incompatible_pkg_license(d, remaining_bad_licenses, pkg_dic[pkg]["LICENSE"]) + incompatible_licenses = oe.license.incompatible_pkg_license(d, remaining_bad_licenses, pkg_dic[pkg]["LICENSE"]) if incompatible_licenses: bb.fatal("Package %s cannot be installed into the image because it has incompatible license(s): %s" %(pkg, ' '.join(incompatible_licenses))) else: - incompatible_licenses = incompatible_pkg_license(d, bad_licenses, pkg_dic[pkg]["LICENSE"]) + incompatible_licenses = oe.license.incompatible_pkg_license(d, bad_licenses, pkg_dic[pkg]["LICENSE"]) if incompatible_licenses: oe.qa.handle_error('license-incompatible', "Including %s with incompatible license(s) %s into the image, because it has been allowed by exception list." %(pkg, ' '.join(incompatible_licenses)), d) try: (pkg_dic[pkg]["LICENSE"], pkg_dic[pkg]["LICENSES"]) = \ oe.license.manifest_licenses(pkg_dic[pkg]["LICENSE"], - remaining_bad_licenses, canonical_license, d) + remaining_bad_licenses, oe.license.canonical_license, d) except oe.license.LicenseError as exc: bb.fatal('%s: %s' % (d.getVar('P'), exc)) @@ -144,7 +144,7 @@ def write_license_files(d, license_manifest, pkg_dic, rootfs=True): if not os.path.exists(pkg_license_dir ): bb.fatal("Couldn't find license information for dependency %s" % pkg) - pkg_manifest_licenses = [canonical_license(d, lic) \ + pkg_manifest_licenses = [oe.license.canonical_license(d, lic) \ for lic in pkg_dic[pkg]["LICENSES"]] licenses = os.listdir(pkg_license_dir) @@ -153,7 +153,7 @@ def write_license_files(d, license_manifest, pkg_dic, rootfs=True): pkg_rootfs_license = os.path.join(pkg_rootfs_license_dir, lic) if re.match(r"^generic_.*$", lic): - generic_lic = canonical_license(d, + generic_lic = oe.license.canonical_license(d, re.search(r"^generic_(.*)$", lic).group(1)) # Do not copy generic license into package if isn't @@ -176,7 +176,7 @@ def write_license_files(d, license_manifest, pkg_dic, rootfs=True): if not os.path.exists(pkg_rootfs_license): os.symlink(os.path.join('..', generic_lic_file), pkg_rootfs_license) else: - if (oe.license.license_ok(canonical_license(d, + if (oe.license.license_ok(oe.license.canonical_license(d, lic), bad_licenses) == False or os.path.exists(pkg_rootfs_license)): continue diff --git a/meta/lib/oe/license.py b/meta/lib/oe/license.py index d9c8d94da4..7739697c40 100644 --- a/meta/lib/oe/license.py +++ b/meta/lib/oe/license.py @@ -259,3 +259,166 @@ def apply_pkg_license_exception(pkg, bad_licenses, exceptions): """Return remaining bad licenses after removing any package exceptions""" return [lic for lic in bad_licenses if pkg + ':' + lic not in exceptions] + +def return_spdx(d, license): + """ + This function returns the spdx mapping of a license if it exists. + """ + return d.getVarFlag('SPDXLICENSEMAP', license) + +def canonical_license(d, license): + """ + Return the canonical (SPDX) form of the license if available (so GPLv3 + becomes GPL-3.0-only) or the passed license if there is no canonical form. + """ + return d.getVarFlag('SPDXLICENSEMAP', license) or license + +def expand_wildcard_licenses(d, wildcard_licenses): + """ + There are some common wildcard values users may want to use. Support them + here. + """ + licenses = set(wildcard_licenses) + mapping = { + "AGPL-3.0*" : ["AGPL-3.0-only", "AGPL-3.0-or-later"], + "GPL-3.0*" : ["GPL-3.0-only", "GPL-3.0-or-later"], + "LGPL-3.0*" : ["LGPL-3.0-only", "LGPL-3.0-or-later"], + } + for k in mapping: + if k in wildcard_licenses: + licenses.remove(k) + for item in mapping[k]: + licenses.add(item) + + for l in licenses: + if l in obsolete_license_list(): + bb.fatal("Error, %s is an obsolete license, please use an SPDX reference in INCOMPATIBLE_LICENSE" % l) + if "*" in l: + bb.fatal("Error, %s is an invalid license wildcard entry" % l) + + return list(licenses) + +def incompatible_license_contains(license, truevalue, falsevalue, d): + license = canonical_license(d, license) + bad_licenses = (d.getVar('INCOMPATIBLE_LICENSE') or "").split() + bad_licenses = expand_wildcard_licenses(d, bad_licenses) + return truevalue if license in bad_licenses else falsevalue + +def incompatible_pkg_license(d, dont_want_licenses, license): + # Handles an "or" or two license sets provided by + # flattened_licenses(), pick one that works if possible. + def choose_lic_set(a, b): + return a if all(license_ok(canonical_license(d, lic), + dont_want_licenses) for lic in a) else b + + try: + licenses = flattened_licenses(license, choose_lic_set) + except LicenseError as exc: + bb.fatal('%s: %s' % (d.getVar('P'), exc)) + + incompatible_lic = [] + for l in licenses: + license = canonical_license(d, l) + if not license_ok(license, dont_want_licenses): + incompatible_lic.append(license) + + return sorted(incompatible_lic) + +def incompatible_license(d, dont_want_licenses, package=None): + """ + This function checks if a recipe has only incompatible licenses. It also + take into consideration 'or' operand. dont_want_licenses should be passed + as canonical (SPDX) names. + """ + license = d.getVar("LICENSE:%s" % package) if package else None + if not license: + license = d.getVar('LICENSE') + + return incompatible_pkg_license(d, dont_want_licenses, license) + +def check_license_flags(d): + """ + This function checks if a recipe has any LICENSE_FLAGS that + aren't acceptable. + + If it does, it returns the all LICENSE_FLAGS missing from the list + of acceptable license flags, or all of the LICENSE_FLAGS if there + is no list of acceptable flags. + + If everything is is acceptable, it returns None. + """ + + def license_flag_matches(flag, acceptlist, pn): + """ + Return True if flag matches something in acceptlist, None if not. + + Before we test a flag against the acceptlist, we append _${PN} + to it. We then try to match that string against the + acceptlist. This covers the normal case, where we expect + LICENSE_FLAGS to be a simple string like 'commercial', which + the user typically matches exactly in the acceptlist by + explicitly appending the package name e.g 'commercial_foo'. + If we fail the match however, we then split the flag across + '_' and append each fragment and test until we either match or + run out of fragments. + """ + flag_pn = ("%s_%s" % (flag, pn)) + for candidate in acceptlist: + if flag_pn == candidate: + return True + + flag_cur = "" + flagments = flag_pn.split("_") + flagments.pop() # we've already tested the full string + for flagment in flagments: + if flag_cur: + flag_cur += "_" + flag_cur += flagment + for candidate in acceptlist: + if flag_cur == candidate: + return True + return False + + def all_license_flags_match(license_flags, acceptlist): + """ Return all unmatched flags, None if all flags match """ + pn = d.getVar('PN') + split_acceptlist = acceptlist.split() + flags = [] + for flag in license_flags.split(): + if not license_flag_matches(flag, split_acceptlist, pn): + flags.append(flag) + return flags if flags else None + + license_flags = d.getVar('LICENSE_FLAGS') + if license_flags: + acceptlist = d.getVar('LICENSE_FLAGS_ACCEPTED') + if not acceptlist: + return license_flags.split() + unmatched_flags = all_license_flags_match(license_flags, acceptlist) + if unmatched_flags: + return unmatched_flags + return None + +def check_license_format(d): + """ + This function checks if LICENSE is well defined, + Validate operators in LICENSES. + No spaces are allowed between LICENSES. + """ + pn = d.getVar('PN') + licenses = d.getVar('LICENSE') + + elements = list(filter(lambda x: x.strip(), license_operator.split(licenses))) + for pos, element in enumerate(elements): + if license_pattern.match(element): + if pos > 0 and license_pattern.match(elements[pos - 1]): + oe.qa.handle_error('license-format', + '%s: LICENSE value "%s" has an invalid format - license names ' \ + 'must be separated by the following characters to indicate ' \ + 'the license selection: %s' % + (pn, licenses, license_operator_chars), d) + elif not license_operator.match(element): + oe.qa.handle_error('license-format', + '%s: LICENSE value "%s" has an invalid separator "%s" that is not ' \ + 'in the valid list of separators (%s)' % + (pn, licenses, element, license_operator_chars), d)