From patchwork Tue Jul 1 14:42:50 2025 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 7bit X-Patchwork-Submitter: Thomas Perrot X-Patchwork-Id: 65928 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.0 (2014-02-07) on aws-us-west-2-korg-lkml-1.web.codeaurora.org Received: from aws-us-west-2-korg-lkml-1.web.codeaurora.org (localhost.localdomain [127.0.0.1]) by smtp.lore.kernel.org (Postfix) with ESMTP id A6A34C83038 for ; Tue, 1 Jul 2025 14:45:04 +0000 (UTC) Received: from relay2-d.mail.gandi.net (relay2-d.mail.gandi.net [217.70.183.194]) by mx.groups.io with SMTP id smtpd.web10.12643.1751381103231305830 for ; Tue, 01 Jul 2025 07:45:03 -0700 Authentication-Results: mx.groups.io; dkim=pass header.i=@bootlin.com header.s=gm1 header.b=NmXmqeIL; spf=pass (domain: bootlin.com, ip: 217.70.183.194, mailfrom: thomas.perrot@bootlin.com) Received: by mail.gandi.net (Postfix) with ESMTPSA id 2D20143860; Tue, 1 Jul 2025 14:45:00 +0000 (UTC) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=bootlin.com; s=gm1; t=1751381101; h=from:from:reply-to:subject:subject:date:date:message-id:message-id: to:to:cc:cc:mime-version:mime-version: content-transfer-encoding:content-transfer-encoding; bh=XOFqICXMSpv0sQx+LgsQqH5bg6rZtPiB/DV+Dxq2Svk=; b=NmXmqeILGXiww5H8av22l9ffk4TzKLQzu4e8YTuiGnujlcTv6yT3dAKqJ8vJRfqqvrpTGg 7jm5rOKUgeTCXxlCLIy2/c6AFm/14xms1PtwO/wdlm10zq/qAWkQWh9ZaDuBTfG57Pb6Is r4m+PUN80oZLOUWw9hh4zea7vACIzmvUQEHSXUMQQb/4o+dp7Y4er83XDG0+M56guW+R0w Dt37smcyLXt7+pPMC4dlVlagA7aETEe3DjSqXigR5g1U150gQs3VT5hEg5VujCl52tkSYF H4bZOIMB9MsTtt/YFwm4P6Iuq8d5ZCI191o1FcReAu4S6NIWijdpUS7ZaTlnHw== From: thomas.perrot@bootlin.com To: openembedded-core@lists.openembedded.org Cc: thomas.petazzoni@bootlin.com, Thomas Perrot Subject: [OE-core][PATCH] opensbi: bump to 1.7 Date: Tue, 1 Jul 2025 16:42:50 +0200 Message-ID: <20250701144250.231485-1-thomas.perrot@bootlin.com> X-Mailer: git-send-email 2.50.0 MIME-Version: 1.0 X-GND-State: clean X-GND-Score: -100 X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtdefgddugeejlecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfitefpfffkpdcuggftfghnshhusghstghrihgsvgenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkofgggfestdekredtredttdenucfhrhhomhepthhhohhmrghsrdhpvghrrhhothessghoohhtlhhinhdrtghomhenucggtffrrghtthgvrhhnpedvueethfejueevleetiefffedvgeejtddtiedvieffieetjeekhfdvvdevkeetueenucffohhmrghinhepihhnfhhrrgguvggrugdrohhrghdpghhithhhuhgsrdgtohhmnecukfhppeekvddrieeirddvheegrdegjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeekvddrieeirddvheegrdegjedphhgvlhhopeigphhsudefqdduudeihehgjedpmhgrihhlfhhrohhmpehthhhomhgrshdrphgvrhhrohhtsegsohhothhlihhnrdgtohhmpdhnsggprhgtphhtthhopeefpdhrtghpthhtohepohhpvghnvghmsggvugguvgguqdgtohhrvgeslhhishhtshdrohhpvghnvghmsggvugguvggurdhorhhgpdhrtghpthhtohepthhhohhmrghsrdhpvghtrgiiiihonhhisegsohhothhlihhnrdgtohhmpdhrtghpthhtohepthhhohhmrghsrdhpvghrrhhothessghoohhtlhhinhdrtghomh X-GND-Sasl: thomas.perrot@bootlin.com List-Id: X-Webhook-Received: from li982-79.members.linode.com [45.33.32.79] by aws-us-west-2-korg-lkml-1.web.codeaurora.org with HTTPS for ; Tue, 01 Jul 2025 14:45:04 -0000 X-Groupsio-URL: https://lists.openembedded.org/g/openembedded-core/message/219584 From: Thomas Perrot This release has: - New parameter in top-level Makefile for reproducible builds - Added MIPS P8700 platform support - Allow arbitrary path in LLVM parameter of top-level Makefile - Improved SBI v3.0 extensions to match frozen specification - Emulate AMO instructions when Zaamo is not available - Stop the harts waiting for HSM start from supervisor software - Improved generic platform overrides to use common fdt_driver helpers - Improved SBI MPXY framework to use per-domain data - Added support for control transfer records (CTR) ISA extension - Use LR and SC when Zaamo ISA extension is not available - Added PXA UART support - Added support for double-trap ISA extensions - Optimized hartid and scratch lookup - Added unit tests for bitwise operations - Added unit tests for SBI ecall functionality - Constify various FDT driver definitions - Added MPXY RPMI mailbox driver for System MSI service group - Improved RPMI drivers to match frozen specifications - Initialize miscellaneous early drivers in one pass - Use fdt_driver helpers for irqchip driver framework - Allow adding SSE events dynamically at boot-time - Simple singly linked list implementation Overall, this release adds more ISA extensions and does many device driver improvements. Signed-off-by: Thomas Perrot --- ...lag-for-reprodubility-compiler-flags.patch | 49 ------------------- .../{opensbi_1.6.bb => opensbi_1.7.bb} | 6 +-- 2 files changed, 2 insertions(+), 53 deletions(-) delete mode 100644 meta/recipes-bsp/opensbi/opensbi/0001-Makefile-Add-flag-for-reprodubility-compiler-flags.patch rename meta/recipes-bsp/opensbi/{opensbi_1.6.bb => opensbi_1.7.bb} (93%) diff --git a/meta/recipes-bsp/opensbi/opensbi/0001-Makefile-Add-flag-for-reprodubility-compiler-flags.patch b/meta/recipes-bsp/opensbi/opensbi/0001-Makefile-Add-flag-for-reprodubility-compiler-flags.patch deleted file mode 100644 index e650476f50ff..000000000000 --- a/meta/recipes-bsp/opensbi/opensbi/0001-Makefile-Add-flag-for-reprodubility-compiler-flags.patch +++ /dev/null @@ -1,49 +0,0 @@ -From f4c440219f42d74bd3d6688132ea876f3f51e601 Mon Sep 17 00:00:00 2001 -From: Khem Raj -Date: Wed, 14 May 2025 19:50:24 -0700 -Subject: [PATCH] Makefile: Add flag for reprodubility compiler flags - -Provides mechanism to remove absolute paths from binaries using --ffile-prefix-map - -It will help distros (e.g. yocto based ones ) which want to ship -the .elf files but need to scrub absolute paths in objects - -Upstream-Status: Submitted [https://lists.infradead.org/pipermail/opensbi/2025-May/008458.html] -Signed-off-by: Khem Raj ---- - Makefile | 7 +++++++ - 1 file changed, 7 insertions(+) - -diff --git a/Makefile b/Makefile -index e90836c7..22d4ecff 100644 ---- a/Makefile -+++ b/Makefile -@@ -174,6 +174,11 @@ else - USE_LD_FLAG = -fuse-ld=bfd - endif - -+REPRODUCIBLE ?= n -+ifeq ($(REPRODUCIBLE),y) -+REPRODUCIBLE_FLAGS += -ffile-prefix-map=$(src_dir)= -+endif -+ - # Check whether the linker supports creating PIEs - OPENSBI_LD_PIE := $(shell $(CC) $(CLANG_TARGET) $(RELAX_FLAG) $(USE_LD_FLAG) -fPIE -nostdlib -Wl,-pie -x c /dev/null -o /dev/null >/dev/null 2>&1 && echo y || echo n) - -@@ -362,6 +367,7 @@ GENFLAGS += $(firmware-genflags-y) - - CFLAGS = -g -Wall -Werror -ffreestanding -nostdlib -fno-stack-protector -fno-strict-aliasing -ffunction-sections -fdata-sections - CFLAGS += -fno-omit-frame-pointer -fno-optimize-sibling-calls -+CFLAGS += $(REPRODUCIBLE_FLAGS) - # Optionally supported flags - ifeq ($(CC_SUPPORT_VECTOR),y) - CFLAGS += -DOPENSBI_CC_SUPPORT_VECTOR -@@ -387,6 +393,7 @@ CPPFLAGS += $(firmware-cppflags-y) - ASFLAGS = -g -Wall -nostdlib - ASFLAGS += -fno-omit-frame-pointer -fno-optimize-sibling-calls - ASFLAGS += -fPIE -+ASFLAGS += $(REPRODUCIBLE_FLAGS) - # Optionally supported flags - ifeq ($(CC_SUPPORT_SAVE_RESTORE),y) - ASFLAGS += -mno-save-restore diff --git a/meta/recipes-bsp/opensbi/opensbi_1.6.bb b/meta/recipes-bsp/opensbi/opensbi_1.7.bb similarity index 93% rename from meta/recipes-bsp/opensbi/opensbi_1.6.bb rename to meta/recipes-bsp/opensbi/opensbi_1.7.bb index 308ac43ac85d..a460062e9398 100644 --- a/meta/recipes-bsp/opensbi/opensbi_1.6.bb +++ b/meta/recipes-bsp/opensbi/opensbi_1.7.bb @@ -8,10 +8,8 @@ require opensbi-payloads.inc inherit deploy -SRCREV = "bd613dd92113f683052acfb23d9dc8ba60029e0a" -SRC_URI = "git://github.com/riscv/opensbi.git;branch=master;protocol=https \ - file://0001-Makefile-Add-flag-for-reprodubility-compiler-flags.patch \ -" +SRCREV = "a32a91069119e7a5aa31e6bc51d5e00860be3d80" +SRC_URI = "git://github.com/riscv/opensbi.git;branch=master;protocol=https" TARGET_DBGSRC_DIR = "/share/opensbi/*/generic/firmware/"